PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA04G18450.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family DBB
Protein Properties Length: 254aa    MW: 26988.1 Da    PI: 4.8996
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA04G18450.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.61.9e-06443538
         zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                      C+ +  + ++ fC  ++  lC+ C    H+       H+
  ONIVA04G18450.2  4 QCDVCAAEAASVFCCADEAALCDACDRRVHSAnklagkHR 43
                     7**************************9996566777776 PP

2zf-B_box26.31.6e-085992235
         zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeHk 35
                     +++ C+ ++ek+  lfC++++  lC++C ++ H 
  ONIVA04G18450.2 59 KPPLCDICQEKRGFLFCKEDRAILCRECDVAVHT 92
                     6899***************************994 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003363.0E-11147IPR000315B-box-type zinc finger
PROSITE profilePS501199.84147IPR000315B-box-type zinc finger
CDDcd000213.71E-7347No hitNo description
PfamPF006432.1E-5444IPR000315B-box-type zinc finger
SMARTSM003363.4E-1458105IPR000315B-box-type zinc finger
PROSITE profilePS5011910.16858105IPR000315B-box-type zinc finger
PfamPF006437.6E-75992IPR000315B-box-type zinc finger
CDDcd000219.74E-961105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009641Biological Processshade avoidance
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MKVQCDVCAA EAASVFCCAD EAALCDACDR RVHSANKLAG KHRRFSLLQP LASSSSAQKP  60
PLCDICQEKR GFLFCKEDRA ILCRECDVAV HTTSELTRRH GRFLLTGVRL SSAPMDSPAP  120
SEEEEEEAGE DYSCSPSSVA GTAAGSASDG SSISEYLTKT LPGWHVEDFL VDEATAAAAA  180
ASSSSDGLFQ GGLLAQIGGV PDGYAAWAGR EQLHSGVAVA ADERASRERW VPQMNAEWGA  240
GSKRPRASPP CLYW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0613330.0AK061333.1 Oryza sativa Japonica Group cDNA clone:006-303-A11, full insert sequence.
GenBankCT8301690.0CT830169.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA102E21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634023.11e-175PREDICTED: B-box zinc finger protein 20 isoform X2
SwissprotQ9LQZ75e-57BBX21_ARATH; B-box zinc finger protein 21
TrEMBLA0A0E0H3P40.0A0A0E0H3P4_ORYNI; Uncharacterized protein
STRINGLOC_Os04g45690.11e-175(Oryza sativa Japonica Group)
STRINGBGIOSGA016847-PA1e-175(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75540.19e-29salt tolerance homolog2